PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10029556
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 128aa    MW: 13956.3 Da    PI: 10.2244
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10029556genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.85.2e-271059251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 ri+n++ rqvtfskRr+g+lKKA+EL +LCda+va++ifsst kly++s+
  Lus10029556 10 RIDNSTSRQVTFSKRRKGLLKKAKELAILCDADVALLIFSSTHKLYDFSN 59
                 8***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.202161IPR002100Transcription factor, MADS-box
SMARTSM004329.3E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-27261IPR002100Transcription factor, MADS-box
CDDcd002652.17E-38260No hitNo description
PRINTSPR004047.4E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.2E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004047.4E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004047.4E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MGRGKIEIRR IDNSTSRQVT FSKRRKGLLK KAKELAILCD ADVALLIFSS THKLYDFSNT  60
RKEVRPEGPN IAGADPKLYN PIETIMQLGG SPLANLHVLC LLEHGLPSSM TSMTHVLRLS  120
CVPLAGS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A7e-18260159Myocyte-specific enhancer factor 2A
3mu6_B7e-18260159Myocyte-specific enhancer factor 2A
3mu6_C7e-18260159Myocyte-specific enhancer factor 2A
3mu6_D7e-18260159Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012838839.16e-32PREDICTED: MADS-box transcription factor 27-like
SwissprotQ6VAM42e-30MAD23_ORYSJ; MADS-box transcription factor 23
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22630.13e-30AGAMOUS-like 17